PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Seita.9G367200.1.p
Common NameLOC101767581, SETIT_036728mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Cenchrinae; Setaria
Family NF-YA
Protein Properties Length: 314aa    MW: 34375.3 Da    PI: 9.6379
Description NF-YA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Seita.9G367200.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1CBFB_NFYA105.73.9e-33157213158
           CBFB_NFYA   1 deplYVNaKQyqrIlkRRqkRakleeekkldeksrkpylheSRhkhAlrRpRgsgGrF 58 
                         +ep++VNaKQy++Il+RRq+Rakle+++kl  k+rkpylheSRh hA++R Rg+gGrF
  Seita.9G367200.1.p 157 EEPIFVNAKQYHAILRRRQMRAKLEAQNKL-VKGRKPYLHESRHCHAMKRVRGPGGRF 213
                         69****************************.**************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005215.5E-37155216IPR001289Nuclear transcription factor Y subunit A
PROSITE profilePS5115238.047156216IPR001289Nuclear transcription factor Y subunit A
PfamPF020451.3E-27158213IPR001289Nuclear transcription factor Y subunit A
PRINTSPR006161.4E-23159181IPR001289Nuclear transcription factor Y subunit A
PROSITE patternPS006860161181IPR018362CCAAT-binding factor, conserved site
PRINTSPR006161.4E-23190213IPR001289Nuclear transcription factor Y subunit A
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0016602Cellular ComponentCCAAT-binding factor complex
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 314 aa     Download sequence    Send to blast
MLLREMDGDP FHTMPNYDFL SGNGYSMKQL NCSNSDRDSS STKSEQSRQD LSAVSDGSLN  60
GQHTPTQSGL FSPSENNDSC GKRDQGMVKS VLSFGNPEAD FSPPKFDYSQ PFACASYTAD  120
PYYGGVLTGY SSNSIVRPQI NGATNSRVPL PIEPAAEEPI FVNAKQYHAI LRRRQMRAKL  180
EAQNKLVKGR KPYLHESRHC HAMKRVRGPG GRFLNKKELQ EQQQREKAPP SLHTPTGGVG  240
KMAFGRNLCP ENSTSHSPST SSGISSVSNG GGMMAHQEHI SFSSPNFLPS MNFRKENGSE  300
KMAVNGVRHR TPS*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4awl_A8e-22157218263NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT ALPHA
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004984044.10.0PREDICTED: nuclear transcription factor Y subunit A-4-like isoform X1
RefseqXP_004984045.10.0PREDICTED: nuclear transcription factor Y subunit A-4-like isoform X1
TrEMBLK4ACX10.0K4ACX1_SETIT; Uncharacterized protein
STRINGSi036728m0.0(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP137338121
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G72830.14e-33nuclear factor Y, subunit A3